human ybx1 construct (Novus Biologicals)
Novus Biologicals is a verified supplier 
Novus Biologicals manufactures this product 
92
Structured Review
Novus Biologicals
human ybx1 construct
Human Ybx1 Construct, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 92/100, based on 4 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/human+ybx1+construct/Recombinant+Human+YB1+His+Protein/pmc05695045-183-16-19
Average 92 stars, based on 4 article reviews
Human Ybx1 Construct, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 92/100, based on 4 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/human+ybx1+construct/Recombinant+Human+YB1+His+Protein/pmc05695045-183-16-19
Average 92 stars, based on 4 article reviews
human ybx1 construct - by Bioz Stars,
2026-10
92/100 stars
Images
1) Product Images from "Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements"
Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements
Journal: Journal of proteome research
doi: 10.1021/acs.jproteome.7b00442
Figure Legend Snippet: High confidence TAM-induced protein stability hits.
Techniques Used: Multiplex sample analysis
Figure Legend Snippet: Pulse proteolysis with purified recombinant YBX1 +/− TAM. A) Pulse proteolysis of YBX1 +/− TAM in increasing concentration of urea. Red box depicting TAM-induced difference at 0.75 M Urea. B) Intact YBX1 and pulse proteolysis of YBX1 in the absence of TAM at low and high denaturant.
Techniques Used: Purification, Recombinant, Concentration Assay
Figure Legend Snippet: SPROX data generated on YBX1 +/− TAM. The filled circles represent data generated on the YBX1 peptide RPQYSNPPVQGEVMEGADNQGAGEQGRPVR in the PAB-SPROX analysis of the purified recombinant YBX1 construct. The open circles represent data on the oxidized version of the same YBX1 peptide in the SILAC-SPROX analysis of the unpurified protein in the MCF-7 cell lysate. Both data sets are consistent with a TAM-induced stabilization of YBX1.
Techniques Used: Generated, Purification, Recombinant, Construct, Multiplex sample analysis
Figure Legend Snippet: STRING analysis of the 27 high-confidence TAM and NDT hits. The STRING analysis was conducted using medium confidence data from experiments. Also included in the STRING analysis were the MAPK1, AKT1 and ESR1 (see text). The red dashed line represents an experimentally observed direct interaction between ER and YBX1 that was recently reported in reference.34
Techniques Used:
Related Articles
Purification:Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: Samples were heated to 95°C for 5 minutes before a 40 μL aliquot of each sample was loaded onto a 4%–20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subject to an electrophoretic separation and visualization with coomassie staining. .. A PAB-SPROX experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: .. A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: .. Pulse Proteolysis Protocol A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements. Article Snippet: .. A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: Samples were heated to 95°C for 5 minutes before a 40 μL aliquot of each sample was loaded onto a 4%–20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subject to an electrophoretic separation and visualization with coomassie staining. .. SPROX Protocol with Phenacyl Bromide Labelling (PAB-SPROX) A PAB-SPROX experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements. Article Snippet: Samples were heated at 95 °C for 5 min before a 40 μL aliquot of each sample was loaded onto a 4−20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subjected to electrophoretic separation and visualization with Coomassie staining. .. A PAB-SPROX experiment was performed on a purified recombinant Recombinant:Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: Samples were heated to 95°C for 5 minutes before a 40 μL aliquot of each sample was loaded onto a 4%–20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subject to an electrophoretic separation and visualization with coomassie staining. .. A PAB-SPROX experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: .. A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: .. Pulse Proteolysis Protocol A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements. Article Snippet: .. A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: Samples were heated to 95°C for 5 minutes before a 40 μL aliquot of each sample was loaded onto a 4%–20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subject to an electrophoretic separation and visualization with coomassie staining. .. SPROX Protocol with Phenacyl Bromide Labelling (PAB-SPROX) A PAB-SPROX experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements. Article Snippet: Samples were heated at 95 °C for 5 min before a 40 μL aliquot of each sample was loaded onto a 4−20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subjected to electrophoretic separation and visualization with Coomassie staining. .. A PAB-SPROX experiment was performed on a purified recombinant Construct:Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: Samples were heated to 95°C for 5 minutes before a 40 μL aliquot of each sample was loaded onto a 4%–20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subject to an electrophoretic separation and visualization with coomassie staining. .. A PAB-SPROX experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: .. A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: .. Pulse Proteolysis Protocol A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements. Article Snippet: .. A pulse proteolysis experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements Article Snippet: Samples were heated to 95°C for 5 minutes before a 40 μL aliquot of each sample was loaded onto a 4%–20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subject to an electrophoretic separation and visualization with coomassie staining. .. SPROX Protocol with Phenacyl Bromide Labelling (PAB-SPROX) A PAB-SPROX experiment was performed on a purified recombinant Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements. Article Snippet: Samples were heated at 95 °C for 5 min before a 40 μL aliquot of each sample was loaded onto a 4−20% midsize polyacrylamide gel (BioRad Criterion, Hercules, CA, USA) and subjected to electrophoretic separation and visualization with Coomassie staining. .. A PAB-SPROX experiment was performed on a purified recombinant |
